Lineage for d3zqua_ (3zqu A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864431Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864432Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) (S)
  5. 2864471Family c.34.1.0: automated matches [191535] (1 protein)
    not a true family
  6. 2864472Protein automated matches [190910] (10 species)
    not a true protein
  7. 2864498Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189793] (14 PDB entries)
  8. 2864499Domain d3zqua_: 3zqu A: [186518]
    automated match to d1sbza_
    complexed with fnr, so4

Details for d3zqua_

PDB Entry: 3zqu (more details), 1.5 Å

PDB Description: structure of a probable aromatic acid decarboxylase
PDB Compounds: (A:) Probable aromatic acid decarboxylase

SCOPe Domain Sequences for d3zqua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zqua_ c.34.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
msgperitlamtgasgaqyglrlldclvqeerevhfliskaaqlvmatetdvalpakpqa
mqaflteycgaaagqirvfgqndwmappasgssapnamvicpcstgtlsavatgacnnli
eraadvalkerrplvlvpreapfssihlenmlklsnlgavilpaapgfyhqpqsvedlvd
fvvarilntlgipqdmlprwgeqhlvs

SCOPe Domain Coordinates for d3zqua_:

Click to download the PDB-style file with coordinates for d3zqua_.
(The format of our PDB-style files is described here.)

Timeline for d3zqua_: