Lineage for d3zood_ (3zoo D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476826Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1476827Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1476828Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1477026Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 1477137Species Human (Homo sapiens) [TaxId:9606] [109644] (4 PDB entries)
    Uniprot P99999
  8. 1477141Domain d3zood_: 3zoo D: [228576]
    automated match to d1j3sa_
    complexed with hem, po4; mutant

Details for d3zood_

PDB Entry: 3zoo (more details), 1.35 Å

PDB Description: structure of the y46f mutant of human cytochrome c
PDB Compounds: (D:) cytochrome c

SCOPe Domain Sequences for d3zood_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zood_ a.3.1.1 (D:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgfsytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

SCOPe Domain Coordinates for d3zood_:

Click to download the PDB-style file with coordinates for d3zood_.
(The format of our PDB-style files is described here.)

Timeline for d3zood_: