Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Mitochondrial cytochrome c [46642] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [109644] (13 PDB entries) Uniprot P99999 |
Domain d3zood_: 3zoo D: [228576] automated match to d1j3sa_ complexed with hec, po4; mutant |
PDB Entry: 3zoo (more details), 1.35 Å
SCOPe Domain Sequences for d3zood_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zood_ a.3.1.1 (D:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]} gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgfsytaanknkgiiwg edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
Timeline for d3zood_: