Lineage for d3zoba_ (3zob A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1721270Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1721271Protein automated matches [190674] (16 species)
    not a true protein
  7. 1721288Species Chicken (Gallus gallus) [TaxId:9031] [256162] (1 PDB entry)
  8. 1721289Domain d3zoba_: 3zob A: [250810]
    automated match to d1qrya_

Details for d3zoba_

PDB Entry: 3zob (more details)

PDB Description: Solution structure of chicken Engrailed 2 homeodomain
PDB Compounds: (A:) homeobox protein engrailed-2

SCOPe Domain Sequences for d3zoba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zoba_ a.4.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gpmasdkrprtaftaeqlqrlkaefqtnrylteqrrqslaqelglnesqikiwfqnkrak
ikkatqa

SCOPe Domain Coordinates for d3zoba_:

Click to download the PDB-style file with coordinates for d3zoba_.
(The format of our PDB-style files is described here.)

Timeline for d3zoba_: