Lineage for d3zo0b_ (3zo0 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781734Family b.29.1.22: SPRY domain [141154] (6 proteins)
    Pfam PF00622
  6. 1781756Protein automated matches [190921] (2 species)
    not a true protein
  7. 1781759Species Mouse (Mus musculus) [TaxId:10090] [188414] (2 PDB entries)
  8. 1781762Domain d3zo0b_: 3zo0 B: [193163]
    Other proteins in same PDB: d3zo0a1, d3zo0a2
    automated match to d2volb_
    complexed with fuc, man

Details for d3zo0b_

PDB Entry: 3zo0 (more details), 1.99 Å

PDB Description: mouse igg2a in complex with mouse trim21 pryspry
PDB Compounds: (B:) e3 ubiquitin-protein ligase trim21

SCOPe Domain Sequences for d3zo0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zo0b_ b.29.1.22 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hmvhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfssgkmyw
evdvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqksyeagtspqttlhiqvppc
qigifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaaplklcpl

SCOPe Domain Coordinates for d3zo0b_:

Click to download the PDB-style file with coordinates for d3zo0b_.
(The format of our PDB-style files is described here.)

Timeline for d3zo0b_: