Lineage for d3zo0a1 (3zo0 A:237-339)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (26 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries) 
Domain d3zo0a1: 3zo0 A:237-339 [201354]
Other proteins in same PDB: d3zo0b_
automated match to d2ql1a1
complexed with fuc, man
Details for d3zo0a1
PDB Entry: 3zo0 (more details), 1.99 Å
PDB Description: mouse igg2a in complex with mouse trim21 pryspry
PDB Compounds: (A:) ig gamma-2a chain c region, a alleleSCOPe Domain Sequences for d3zo0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zo0a1 b.1.1.0 (A:237-339) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredy
nstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskp
SCOPe Domain Coordinates for d3zo0a1:
Click to download the PDB-style file with coordinates for d3zo0a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3zo0a1:
- d3zo0a1 first appeared in SCOPe 2.03
- d3zo0a1 appears in SCOPe 2.04
- d3zo0a1 appears in SCOPe 2.06
- d3zo0a1 appears in the current release, SCOPe 2.08
View in 3D
