Lineage for d3znwa_ (3znw A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. Protein automated matches [190161] (29 species)
    not a true protein
  7. Species Citrobacter freundii [TaxId:546] [235913] (4 PDB entries)
  8. Domain d3znwa_: 3znw A: [306983]
    automated match to d4d2oa_

Details for d3znwa_

PDB Entry: 3znw (more details), 2.09 Å

PDB Description: Crystal structure of the class A extended-spectrum beta-lactamase PER- 2
PDB Compounds: (A:) extended-spectrum beta-lactamase

SCOPe Domain Sequences for d3znwa_:

Sequence, based on SEQRES records: (download)

>d3znwa_ e.3.1.1 (A:) automated matches {Citrobacter freundii [TaxId: 546]}
aqspllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqv
dqgkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfe
lvggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqls
etsqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgr
pllvavfvkdsaesertneaiiaqvaqaayqfelkklsav

Sequence, based on observed residues (ATOM records): (download)

>d3znwa_ e.3.1.1 (A:) automated matches {Citrobacter freundii [TaxId: 546]}
aqspllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqv
dqgkldlnqsvtvnraavtwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelvg
gpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlsets
qallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpll
vavfvkdsaesertneaiiaqvaqaayqfelkklsav

SCOPe Domain Coordinates for d3znwa_ are not available.

Timeline for d3znwa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3znwb_