Lineage for d3zmkb1 (3zmk B:1-86)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879035Species Anopheles funestus [TaxId:62324] [236279] (2 PDB entries)
  8. 2879039Domain d3zmkb1: 3zmk B:1-86 [236287]
    Other proteins in same PDB: d3zmka2, d3zmkb2, d3zmkb3, d3zmkc2, d3zmkd2
    automated match to d2il3a1
    complexed with gsh

Details for d3zmkb1

PDB Entry: 3zmk (more details), 2.01 Å

PDB Description: Anopheles funestus glutathione-s-transferase epsilon 2 (GSTe2) protein structure from different alelles: A single amino acid change confers high level of DDT resistance and cross resistance to permethrin in a major malaria vector in Africa
PDB Compounds: (B:) glutathione s-transferase e2

SCOPe Domain Sequences for d3zmkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zmkb1 c.47.1.0 (B:1-86) automated matches {Anopheles funestus [TaxId: 62324]}
mtklvlytlhlsppcraveltakalgleleqkninllagdhltpefmklnpqhtipvldd
dgtiiteshaimiylvtkygkddtly

SCOPe Domain Coordinates for d3zmkb1:

Click to download the PDB-style file with coordinates for d3zmkb1.
(The format of our PDB-style files is described here.)

Timeline for d3zmkb1: