Lineage for d3zl4l2 (3zl4 L:111-216)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750548Domain d3zl4l2: 3zl4 L:111-216 [236682]
    Other proteins in same PDB: d3zl4l1
    automated match to d2fb4l2
    complexed with mes

Details for d3zl4l2

PDB Entry: 3zl4 (more details), 1.95 Å

PDB Description: antibody structural organization: role of kappa - lambda chain constant domain switch in catalytic functionality
PDB Compounds: (L:) a17 antibody fab fragment lambda light chain

SCOPe Domain Sequences for d3zl4l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zl4l2 b.1.1.2 (L:111-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecsg

SCOPe Domain Coordinates for d3zl4l2:

Click to download the PDB-style file with coordinates for d3zl4l2.
(The format of our PDB-style files is described here.)

Timeline for d3zl4l2:

2750548
d3zl4l2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3zl4l1