Lineage for d3zhwa_ (3zhw A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.2: Globins [46463] (27 proteins)
Heme-binding proteinProtein automated matches [190359] (43 species)
not a true protein
Species Escherichia coli [TaxId:562] [196657] (1 PDB entry) 
Domain d3zhwa_: 3zhw A: [196658]
automated match to d2oifg_
complexed with hem, so4
Details for d3zhwa_
PDB Entry: 3zhw (more details), 2.22 Å
PDB Description: X-ray Crystallographic Structural Characteristics of Arabidopsis Hemoglobin I and their Functional Implications
PDB Compounds: (A:) Non-symbiotic hemoglobin 1SCOPe Domain Sequences for d3zhwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zhwa_ a.1.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
kivfteeqealvvkswsvmkknsaelglklfikifeiapttkkmfsflrdspipaeqnpk
lkphamsvfvmccesavqlrktgkvtvrettlkrlgashskygvvdehfevakyalleti
keavpemwspemkvawgqaydhlvaaikaemnls
SCOPe Domain Coordinates for d3zhwa_:
Click to download the PDB-style file with coordinates for d3zhwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3zhwa_:
- d3zhwa_ first appeared in SCOPe 2.02
- d3zhwa_ appears in SCOPe 2.07
View in 3D
