Lineage for d3zhda_ (3zhd A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (18 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries) 
Domain d3zhda_: 3zhd A: [235925]
automated match to d1vhpa_
complexed with so4
Details for d3zhda_
PDB Entry: 3zhd (more details), 1.96 Å
PDB Description: The crystal structure of single domain antibody 8-4 scaffold.
PDB Compounds: (A:) mg8-4 scaffold antibodySCOPe Domain Sequences for d3zhda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zhda_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftfssyamgwvrqapgkgpevvslisgsggstwy
ddsvkgrftisrdnskntlylqmnslraedtavyycarhapsteapdywgqgtlvtvssl
SCOPe Domain Coordinates for d3zhda_:
Click to download the PDB-style file with coordinates for d3zhda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3zhda_:
- d3zhda_ first appeared in SCOPe 2.03
- d3zhda_ appears in SCOPe 2.04
- d3zhda_ is called d3zhda1 in SCOPe 2.06
- d3zhda_ appears in the current release, SCOPe 2.08, called d3zhda1
View in 3D
