Lineage for d3ze6b_ (3ze6 B:)
- Root: SCOPe 2.08
Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) 
Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
3 domains: (1) all-alpha; (2&3) alpha+betaSuperfamily e.18.1: HydB/Nqo4-like [56762] (3 families) 
Family e.18.1.1: Nickel-iron hydrogenase, large subunit [56763] (2 proteins) Protein automated matches [190109] (8 species)
not a true protein
Species Desulfovibrio vulgaris [TaxId:882] [189199] (13 PDB entries) 
Domain d3ze6b_: 3ze6 B: [197360]
Other proteins in same PDB: d3ze6a_
automated match to d2wpnb_
complexed with cl, fco, fe2, fsx, gol, ni, sby, sf4
Details for d3ze6b_
PDB Entry: 3ze6 (more details), 1.5 Å
PDB Description: 3d structure of the ni-fe-se hydrogenase from d. vulgaris hildenborough in the as-isolated oxidized state at 1.50 angstroms
PDB Compounds: (B:) periplasmic [nifese] hydrogenase, large subunit, selenocys selenocysteine-containingSCOPe Domain Sequences for d3ze6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ze6b_ e.18.1.1 (B:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
grttiaidpvtrieghlkaevvvengkvvdarlsggmyrgfetilrgrdprdasqivqri
cgvcptahstasvlaldeafgakvpnngritrnlifganylqshilhfyhlsaqdfvqgp
dtapfvprfpksdlrlskelnkagvdqyiealevrrichemvalfggrmphvqgqvvgga
teiptkeklveyaarfkkvrdfveqkyvpvvytigskykdmfkvgqgfkaalcvgafpld
nsgkkhlfmpgvyakgkdmpfdpskikeyvkyswfaeettglnykegktipapdkagays
fvkaprydglslevgplarmwvnnpelspvgkkllkdlfgisakkfrdlgeeaafslmgr
hvaraeetyymlgaiegwlkeikagedtvvmpavpasaegtgfteaprgsllhyvkvkds
kidnyqivsaslwncnprddmgqrgaveealigipvddiqnpvnvarlirafdpxlgcav
h
SCOPe Domain Coordinates for d3ze6b_:
Click to download the PDB-style file with coordinates for d3ze6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ze6b_:
- d3ze6b_ first appeared in SCOPe 2.02
- d3ze6b_ appears in SCOPe 2.07
View in 3D
