Lineage for d3zdwa3 (3zdw A:357-511)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381700Protein Spore coat protein A, CotA [89219] (2 species)
  7. 2381701Species Bacillus subtilis [TaxId:1423] [89220] (13 PDB entries)
    Uniprot P07788
  8. 2381725Domain d3zdwa3: 3zdw A:357-511 [218273]
    complexed with cu1, ebs, gol, oxy

Details for d3zdwa3

PDB Entry: 3zdw (more details), 2.4 Å

PDB Description: Substrate and dioxygen binding to the endospore coat laccase CotA from Bacillus subtilis
PDB Compounds: (A:) cota laccase

SCOPe Domain Sequences for d3zdwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zdwa3 b.6.1.3 (A:357-511) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditdp

SCOPe Domain Coordinates for d3zdwa3:

Click to download the PDB-style file with coordinates for d3zdwa3.
(The format of our PDB-style files is described here.)

Timeline for d3zdwa3: