Lineage for d3zcmb_ (3zcm B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (18 families) 
consists of one domain of this fold
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
Pfam PF00665
Protein automated matches [190209] (5 species)
not a true proteinSpecies Human immunodeficiency virus [TaxId:12721] [193331] (20 PDB entries) 
Domain d3zcmb_: 3zcm B: [193332]
automated match to d1bizb_
complexed with act, gol, px3, so4
Details for d3zcmb_
PDB Entry: 3zcm (more details), 1.8 Å
PDB Description: Small molecule inhibitors of the LEDGF site of HIV integrase identified by fragment screening and structure based design.
PDB Compounds: (B:) hiv integraseSCOPe Domain Sequences for d3zcmb_:
Sequence, based on SEQRES records: (download)
>d3zcmb_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdiq
Sequence, based on observed residues (ATOM records): (download)
>d3zcmb_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkgysagerivdiiatdiq
SCOPe Domain Coordinates for d3zcmb_:
Click to download the PDB-style file with coordinates for d3zcmb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3zcmb_:
- d3zcmb_ first appeared in SCOPe 2.02
- d3zcmb_ appears in SCOPe 2.07
View in 3D
