Lineage for d3zc3a1 (3zc3 A:9-141)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1792139Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 1792176Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 1792281Protein automated matches [227029] (5 species)
    not a true protein
  7. 1792295Species Nostoc sp. [TaxId:1168] [229175] (3 PDB entries)
  8. 1792298Domain d3zc3a1: 3zc3 A:9-141 [229179]
    Other proteins in same PDB: d3zc3a2, d3zc3b2
    automated match to d1quea1
    complexed with fad, gol, nap; mutant

Details for d3zc3a1

PDB Entry: 3zc3 (more details), 2.3 Å

PDB Description: ferredoxin-nadp reductase (mutation s80a) complexed with nadp by cocrystallization
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d3zc3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zc3a1 b.43.4.2 (A:9-141) automated matches {Nostoc sp. [TaxId: 1168]}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlyaiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgkeml

SCOPe Domain Coordinates for d3zc3a1:

Click to download the PDB-style file with coordinates for d3zc3a1.
(The format of our PDB-style files is described here.)

Timeline for d3zc3a1:

1792298
d3zc3a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3zc3a2