Lineage for d3zbyd_ (3zby D:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily)
multihelicalSuperfamily a.104.1: Cytochrome P450 [48264] (2 families) 
Family a.104.1.0: automated matches [191509] (1 protein)
not a true familyProtein automated matches [190847] (45 species)
not a true protein
Species Mycobacterium smegmatis [TaxId:246196] [231662] (5 PDB entries) 
Domain d3zbyd_: 3zby D: [250756]
automated match to d2yooa_
complexed with bcd, edo, hem, so4
Details for d3zbyd_
PDB Entry: 3zby (more details), 1.93 Å
PDB Description: ligand-free structure of cyp142 from mycobacterium smegmatis
PDB Compounds: (D:) p450 heme-thiolate proteinSCOPe Domain Sequences for d3zbyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zbyd_ a.104.1.0 (D:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
tqmltrpdvdlvngmfyadggareayrwmranepvfrdrnglaaattyqavldaernpel
fsstggirpdqpgmpymidmddpqhllrrklvnagftrkrvmdkvdsigrlcdtlidavc
ergecdfvrdiaaplpmavigdmlgvlpterdmllkwsddlvcglsshvdeaaiqklmdt
faayteftkdvitkrraeptddlfsvlvnsevegqrmsddeivfetlliliggdettrht
lsggteqllrhrdqwdalvadvdllpgaieemlrwtspvknmcrtltadtvfhgtelrag
ekimlmfesanfdesvfgdpdnfridrnpnshvafgfgthfclgnqlarlelrlmtervl
rrlpdlrladdapvplrpanfvsgpesmpvvftpsapvlahh
SCOPe Domain Coordinates for d3zbyd_:
Click to download the PDB-style file with coordinates for d3zbyd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3zbyd_:
- d3zbyd_ first appeared in SCOPe 2.04
- d3zbyd_ is called d3zbyd1 in SCOPe 2.06
- d3zbyd_ appears in the current release, SCOPe 2.08, called d3zbyd1
View in 3D
