Lineage for d3wxwh_ (3wxw H:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (22 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries) 
Domain d3wxwh_: 3wxw H: [271562]
automated match to d1oauh_
complexed with zn
Details for d3wxwh_
PDB Entry: 3wxw (more details), 2.4 Å
PDB Description: crystal structure of the human adiponectin receptor 2
PDB Compounds: (H:) V region heavy chainSCOPe Domain Sequences for d3wxwh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wxwh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggsiy
nqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsaa
SCOPe Domain Coordinates for d3wxwh_:
Click to download the PDB-style file with coordinates for d3wxwh_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3wxwh_:
- d3wxwh_ first appeared in SCOPe 2.05
- d3wxwh_ appears in SCOPe 2.06
- d3wxwh_ does not appear in SCOPe 2.08
View in 3D
