| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) ![]() automatically mapped to Pfam PF01466 |
| Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins) |
| Protein automated matches [226933] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries) |
| Domain d3wsob2: 3wso B:84-162 [270795] Other proteins in same PDB: d3wsob1 automated match to d4i6jc2 |
PDB Entry: 3wso (more details), 2.6 Å
SCOPe Domain Sequences for d3wsob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wsob2 a.157.1.1 (B:84-162) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikn
dfteeeeaqvrkenqwcee
Timeline for d3wsob2: