Lineage for d3wp3a_ (3wp3 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051304Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2051349Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2051434Species Penicillium funiculosum [TaxId:28572] [110142] (2 PDB entries)
    Uniprot Q9HFH0
  8. 2051435Domain d3wp3a_: 3wp3 A: [261311]
    automated match to d1te1b_

Details for d3wp3a_

PDB Entry: 3wp3 (more details), 1.98 Å

PDB Description: xylanase 11c from talaromyces cellulolyticus (formerly known as acremonium cellulolyticus)
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3wp3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wp3a_ b.29.1.11 (A:) Xylanase II {Penicillium funiculosum [TaxId: 28572]}
qsittsqtgtnngyyysfwtngggevtytngdngeysvtwvncgdftsgkgwnpanaqtv
tysgefntsgnaylavygwttdplveyyilesygtynpssgltllgqvtsdggtydiyst
qrvdqpsiegtstfnqywsvrtekrvggtvttanhfaawkalglemgtynymivstegye
ssgsstitvs

SCOPe Domain Coordinates for d3wp3a_:

Click to download the PDB-style file with coordinates for d3wp3a_.
(The format of our PDB-style files is described here.)

Timeline for d3wp3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3wp3b_