Class b: All beta proteins [48724] (176 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins) |
Protein Interleukin-18 [101782] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101783] (4 PDB entries) |
Domain d3wo2a_: 3wo2 A: [262120] automated match to d1j0sa_ complexed with cps, so4 |
PDB Entry: 3wo2 (more details), 2.33 Å
SCOPe Domain Sequences for d3wo2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wo2a_ b.42.1.2 (A:) Interleukin-18 {Human (Homo sapiens) [TaxId: 9606]} yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy egyflacekerdlfklilkkedelgdrsimftvqned
Timeline for d3wo2a_: