![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) ![]() |
![]() | Family a.102.1.0: automated matches [191318] (1 protein) not a true family |
![]() | Protein automated matches [190108] (21 species) not a true protein |
![]() | Species Rhodothermus marinus [TaxId:29549] [230219] (4 PDB entries) |
![]() | Domain d3wkga_: 3wkg A: [230220] automated match to d1fp3a_ complexed with cl, po4 |
PDB Entry: 3wkg (more details), 1.47 Å
SCOPe Domain Sequences for d3wkga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wkga_ a.102.1.0 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]} tetipdvrrlralqaevheeltenilkfwatrthdpvhggfvgrvgpdgrphpeaprgai lnarilwtfaaayrqlgtplyremaerayryfvrhfvdaehggvywmvaadgrpldtrkh vyaqsfaiyalsewhratggeaalalarsiydliethcadrvhggyveacdrawrpleda rlsakdapeprsmnthlhvleayanlyrvwpetelaarlqalielflraiyhpatghlil ffderwrprsravsfghdieaswllleavdvlgqatlrprvqqaslhlaratlaegrapd gslyyeigeqghldtdrhwwpqaealvgflnayqesgevlfyeaaedvwryirerqrdtr ggewfarvrddgapypddkvdfwkgpyhngracleaiqrlrhllehvrsr
Timeline for d3wkga_: