Lineage for d3wkga_ (3wkg A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276657Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 1276872Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 1276873Protein automated matches [190108] (7 species)
    not a true protein
  7. 1276886Species Rhodothermus marinus [TaxId:29549] [230219] (4 PDB entries)
  8. 1276887Domain d3wkga_: 3wkg A: [230220]
    automated match to d1fp3a_
    complexed with cl, po4

Details for d3wkga_

PDB Entry: 3wkg (more details), 1.47 Å

PDB Description: crystal structure of cellobiose 2-epimerase in complex with glucosylmannose
PDB Compounds: (A:) Cellobiose 2-epimerase

SCOPe Domain Sequences for d3wkga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wkga_ a.102.1.0 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]}
tetipdvrrlralqaevheeltenilkfwatrthdpvhggfvgrvgpdgrphpeaprgai
lnarilwtfaaayrqlgtplyremaerayryfvrhfvdaehggvywmvaadgrpldtrkh
vyaqsfaiyalsewhratggeaalalarsiydliethcadrvhggyveacdrawrpleda
rlsakdapeprsmnthlhvleayanlyrvwpetelaarlqalielflraiyhpatghlil
ffderwrprsravsfghdieaswllleavdvlgqatlrprvqqaslhlaratlaegrapd
gslyyeigeqghldtdrhwwpqaealvgflnayqesgevlfyeaaedvwryirerqrdtr
ggewfarvrddgapypddkvdfwkgpyhngracleaiqrlrhllehvrsr

SCOPe Domain Coordinates for d3wkga_:

Click to download the PDB-style file with coordinates for d3wkga_.
(The format of our PDB-style files is described here.)

Timeline for d3wkga_: