Lineage for d3wjab2 (3wja B:280-580)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.0: automated matches [191313] (1 protein)
not a true familyProtein automated matches [190069] (239 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries) 
Domain d3wjab2: 3wja B:280-580 [259045]
Other proteins in same PDB: d3wjaa1, d3wjab1
automated match to d1gq2a1
Details for d3wjab2
PDB Entry: 3wja (more details), 2.55 Å
PDB Description: the crystal structure of human cytosolic nadp(+)-dependent malic enzyme in apo form
PDB Compounds: (B:) NADP-dependent malic enzymeSCOPe Domain Sequences for d3wjab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wjab2 c.2.1.0 (B:280-580) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqgtasvavagllaalritknklsdqtilfqgageaalgiahlivmalekeglpkekaik
kiwlvdskglivkgrasltqekekfaheheemknleaivqeikptaligvaaiggafseq
ilkdmaafnerpiifalsnptskaecsaeqcykitkgraifasgspfdpvtlpngqtlyp
gqgnnsyvfpgvalgvvacglrqitdniflttaeviaqqvsdkhleegrlypplntirdv
slkiaekivkdayqektatvypepqnkeafvrsqmystdydqilpdcyswpeevqkiqtk
v
SCOPe Domain Coordinates for d3wjab2:
Click to download the PDB-style file with coordinates for d3wjab2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3wjab2:
- d3wjab2 first appeared in SCOPe 2.04
- d3wjab2 appears in SCOPe 2.05
- d3wjab2 appears in SCOPe 2.07
- d3wjab2 appears in the current release, SCOPe 2.08
View in 3D
