Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225016] (2 PDB entries) |
Domain d3wjab1: 3wja B:18-279 [259044] Other proteins in same PDB: d3wjaa2, d3wjab2 automated match to d1gq2a2 |
PDB Entry: 3wja (more details), 2.55 Å
SCOPe Domain Sequences for d3wjab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wjab1 c.58.1.0 (B:18-279) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrhthqrgylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvknfehlns dfdrylllmdlqdrneklfyrvltsdiekfmpivytptvglacqqyslvfrkprglfiti hdrghiasvlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytacggmnpqe clpvildvgteneellkdplyiglrqrrvrgseyddfldefmeavsskygmncliqfedf anvnafrllnkyrnqyctfndd
Timeline for d3wjab1: