Lineage for d3wg4a_ (3wg4 A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.0: automated matches [191363] (1 protein)
not a true familyProtein automated matches [190437] (37 species)
not a true protein
Species Agrocybe cylindracea [TaxId:64608] [225007] (6 PDB entries) 
Domain d3wg4a_: 3wg4 A: [229347]
automated match to d1ww4a_
complexed with peg; mutant
Details for d3wg4a_
PDB Entry: 3wg4 (more details), 1.6 Å
PDB Description: crystal structure of agrocybe cylindracea galectin mutant (n46a) with blood type a antigen tetraose
PDB Compounds: (A:) Galactoside-binding lectinSCOPe Domain Sequences for d3wg4a_:
Sequence, based on SEQRES records: (download)
>d3wg4a_ b.29.1.0 (A:) automated matches {Agrocybe cylindracea [TaxId: 64608]}
khmttsavniynisagasvdlaapvttgdivtffssalnlsagagspantalnllsenga
yllhiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvi
nektviqytkqisgttsslsynstegtsifstvveavtytgla
Sequence, based on observed residues (ATOM records): (download)
>d3wg4a_ b.29.1.0 (A:) automated matches {Agrocybe cylindracea [TaxId: 64608]}
khmttsavniynisagasvdlaapvttgdivtffssalnlsgspantalnllsengayll
hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
tviqytkqisgttsslsynstgtsifstvveavtytgla
SCOPe Domain Coordinates for d3wg4a_:
Click to download the PDB-style file with coordinates for d3wg4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3wg4a_:
- d3wg4a_ first appeared in SCOPe 2.03
- d3wg4a_ appears in SCOPe 2.04
- d3wg4a_ is called d3wg4a1 in SCOPe 2.06
- d3wg4a_ appears in the current release, SCOPe 2.08, called d3wg4a1
View in 3D
