| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Camponotus japonicus [TaxId:84547] [236657] (2 PDB entries) |
| Domain d3weab_: 3wea B: [236658] automated match to d1nepa_ |
PDB Entry: 3wea (more details), 1.8 Å
SCOPe Domain Sequences for d3weab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3weab_ b.1.18.0 (B:) automated matches {Camponotus japonicus [TaxId: 84547]}
fvfedcgsevgkfsdiiisscdpseekcsiireseihvsmkftpsvdvknveakafgvll
dvpvpfplkkpeickdpdsgvkcplkkdveieykvtffvekatpalsleimwefrnekde
kitcvkfpakik
Timeline for d3weab_: