Lineage for d3wdpq_ (3wdp Q:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) 
Protein automated matches [190245] (10 species)
not a true protein
Species Pyrococcus furiosus [TaxId:2261] [189762] (2 PDB entries) 
Domain d3wdpq_: 3wdp Q: [237741]
automated match to d1uwsa_
complexed with gol, po4; mutant
Details for d3wdpq_
PDB Entry: 3wdp (more details), 1.7 Å
PDB Description: structural analysis of a beta-glucosidase mutant derived from a hyperthermophilic tetrameric structure
PDB Compounds: (Q:) Beta-glucosidaseSCOPe Domain Sequences for d3wdpq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wdpq_ c.1.8.4 (Q:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
akfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhl
ykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikelek
ianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldekt
vvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnl
iqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkld
wigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyl
nnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaq
gfrmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtrk
SCOPe Domain Coordinates for d3wdpq_:
Click to download the PDB-style file with coordinates for d3wdpq_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3wdpq_:
- d3wdpq_ first appeared in SCOPe 2.03
- d3wdpq_ appears in SCOPe 2.04
- d3wdpq_ is called d3wdpq1 in SCOPe 2.06
- d3wdpq_ appears in the current release, SCOPe 2.08, called d3wdpq1
View in 3D
