Lineage for d3wd8a1 (3wd8 A:1-235)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. Protein automated matches [196909] (82 species)
    not a true protein
  7. Species Citrus microcarpa [TaxId:164113] [227815] (2 PDB entries)
  8. Domain d3wd8a1: 3wd8 A:1-235 [227818]
    Other proteins in same PDB: d3wd8a3, d3wd8b3, d3wd8c3, d3wd8d3
    automated match to d1cmla1
    complexed with gol

Details for d3wd8a1

PDB Entry: 3wd8 (more details), 2.46 Å

PDB Description: TypeIII polyketide synthases
PDB Compounds: (A:) Type III polyketide synthase quinolone synthase

SCOPe Domain Sequences for d3wd8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wd8a1 c.95.1.0 (A:1-235) automated matches {Citrus microcarpa [TaxId: 164113]}
makvknflnakrskgpasilaigtanpptcfnqsdypdfyfrvtdcehktelkdkfkric
drsavkkrylhvteevlkenpsmrsynapsldarqallieqvpklgkeaaakaikewgqp
lskithlvfsamagvdipgadlrlmnllglepsvkrlmiysqgcfiggaaircakdfaen
nagarvlvvfsdimnmyfhepqeahldilvgqavfgdgaaavivgadpevsierp

SCOPe Domain Coordinates for d3wd8a1 are not available.

Timeline for d3wd8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wd8a2, d3wd8a3
View in 3D
Domains from other chains:
(mouse over for more information)
d3wd8b1, d3wd8b2, d3wd8b3, d3wd8c1, d3wd8c2, d3wd8c3, d3wd8d1, d3wd8d2, d3wd8d3