Lineage for d3wbra_ (3wbr A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1941287Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1941288Protein automated matches [190159] (13 species)
    not a true protein
  7. 1941334Species Human (Homo sapiens) [TaxId:9606] [186882] (65 PDB entries)
  8. 1941509Domain d3wbra_: 3wbr A: [230202]
    automated match to d2ox8a_

Details for d3wbra_

PDB Entry: 3wbr (more details), 2.2 Å

PDB Description: crystal structure of carbohydrate recognition domain of blood dendritic cell antigen-2 (bdca2) lectin (crystal form-3)
PDB Compounds: (A:) C-type lectin domain family 4 member C

SCOPe Domain Sequences for d3wbra_:

Sequence, based on SEQRES records: (download)

>d3wbra_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
scptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyf
lglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchvp
qksickmkk

Sequence, based on observed residues (ATOM records): (download)

>d3wbra_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
scptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyf
lglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrseewgwndihchvpq
ksickmkk

SCOPe Domain Coordinates for d3wbra_:

Click to download the PDB-style file with coordinates for d3wbra_.
(The format of our PDB-style files is described here.)

Timeline for d3wbra_: