Lineage for d3w9eb2 (3w9e B:108-211)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein automated matches [190374] (14 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) 
Domain d3w9eb2: 3w9e B:108-211 [228145]
Other proteins in same PDB: d3w9eb1, d3w9ec_
automated match to d1g9ml2
complexed with nag
Details for d3w9eb2
PDB Entry: 3w9e (more details), 2.3 Å
PDB Description: structure of human monoclonal antibody e317 fab complex with hsv-2 gd
PDB Compounds: (B:) antibody fab light chainSCOPe Domain Sequences for d3w9eb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w9eb2 b.1.1.2 (B:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhklyacevthqglsspvtksfnr
SCOPe Domain Coordinates for d3w9eb2:
Click to download the PDB-style file with coordinates for d3w9eb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3w9eb2:
- d3w9eb2 first appeared in SCOPe 2.03
- d3w9eb2 appears in SCOPe 2.04
- d3w9eb2 appears in SCOPe 2.06
- d3w9eb2 appears in the current release, SCOPe 2.08
View in 3D
