Lineage for d3w3ea_ (3w3e A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) Fold d.2: Lysozyme-like [53954] (1 superfamily)
common alpha+beta motif for the active site regionSuperfamily d.2.1: Lysozyme-like [53955] (12 families) 
Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
automatically mapped to Pfam PF00182Protein automated matches [190455] (7 species)
not a true protein
Species Cowpea (Vigna unguiculata) [TaxId:3917] [193285] (1 PDB entry) 
Domain d3w3ea_: 3w3e A: [193286]
automated match to d1dxja_
Details for d3w3ea_
PDB Entry: 3w3e (more details), 1.5 Å
PDB Description: Structure of Vigna unguiculata chitinase with regulation activity of the plant cell wall
PDB Compounds: (A:) Cotyledoneous yieldin-like proteinSCOPe Domain Sequences for d3w3ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w3ea_ d.2.1.1 (A:) automated matches {Cowpea (Vigna unguiculata) [TaxId: 3917]}
aevgsvigaslfdqllkhrndqacegkgfysynafitaarsfaafgttgdsntrkrevaa
flaqtshettggaatspdgpyawgycfvterdksnrycdgsgpcsagksyygrgpiqlth
nynynaagralgvdlinnpdlvardavvsfktalwfwmtpqgnkpschdvitnrwtpsaa
dkaanrvpgfgvitniingglecgkgptpasgdrigfykrycdvfgvsygpnlncrdqrp
fg
SCOPe Domain Coordinates for d3w3ea_:
Click to download the PDB-style file with coordinates for d3w3ea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3w3ea_:
- d3w3ea_ first appeared in SCOPe 2.02
- d3w3ea_ appears in SCOPe 2.05
- d3w3ea_ appears in SCOPe 2.07
- d3w3ea_ appears in the current release, SCOPe 2.08
View in 3D
