| Class b: All beta proteins [48724] (174 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.14: HupF/HypC-like [159127] (1 family) ![]() contains extra C-terminal helix packed against the beta-barrel side automatically mapped to Pfam PF01455 |
| Family b.40.14.1: HupF/HypC-like [159128] (1 protein) Pfam PF01455 |
| Protein Hydrogenase expression/formation protein HypC [159129] (3 species) |
| Species Thermococcus kodakaraensis [TaxId:311400] [159132] (5 PDB entries) Uniprot Q5JII0 2-72 |
| Domain d3vysa_: 3vys A: [193348] automated match to d2z1cb_ complexed with mg, sf4 |
PDB Entry: 3vys (more details), 2.35 Å
SCOPe Domain Sequences for d3vysa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vysa_ b.40.14.1 (A:) Hydrogenase expression/formation protein HypC {Thermococcus kodakaraensis [TaxId: 311400]}
clavpgkvievngpvavvdfggvkrevrldlmpdtkpgdwvivhtgfaiekld
Timeline for d3vysa_: