Lineage for d3vysa_ (3vys A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1316050Superfamily b.40.14: HupF/HypC-like [159127] (1 family) (S)
    contains extra C-terminal helix packed against the beta-barrel side
    automatically mapped to Pfam PF01455
  5. 1316051Family b.40.14.1: HupF/HypC-like [159128] (1 protein)
    Pfam PF01455
  6. 1316052Protein Hydrogenase expression/formation protein HypC [159129] (3 species)
  7. 1316058Species Thermococcus kodakaraensis [TaxId:311400] [159132] (5 PDB entries)
    Uniprot Q5JII0 2-72
  8. 1316064Domain d3vysa_: 3vys A: [193348]
    automated match to d2z1cb_
    complexed with mg, sf4

Details for d3vysa_

PDB Entry: 3vys (more details), 2.35 Å

PDB Description: Crystal structure of the HypC-HypD-HypE complex (form I)
PDB Compounds: (A:) Hydrogenase expression/formation protein HypC

SCOPe Domain Sequences for d3vysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vysa_ b.40.14.1 (A:) Hydrogenase expression/formation protein HypC {Thermococcus kodakaraensis [TaxId: 311400]}
clavpgkvievngpvavvdfggvkrevrldlmpdtkpgdwvivhtgfaiekld

SCOPe Domain Coordinates for d3vysa_:

Click to download the PDB-style file with coordinates for d3vysa_.
(The format of our PDB-style files is described here.)

Timeline for d3vysa_: