Lineage for d3vwvb_ (3vwv B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1855221Species Mouse (Mus musculus) [TaxId:10090] [225046] (11 PDB entries)
  8. 1855226Domain d3vwvb_: 3vwv B: [227811]
    automated match to d2pn8a_
    complexed with 1pe, acy

Details for d3vwvb_

PDB Entry: 3vwv (more details), 1.8 Å

PDB Description: crystal structure of N-terminally truncated peroxiredoxin 4 from M. musculus
PDB Compounds: (B:) Peroxiredoxin-4

SCOPe Domain Sequences for d3vwvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vwvb_ c.47.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hssglvprgshmpapywegtavingefkelkltdyrgkylvfffypldftfvcpteiiaf
gdrieefksintevvacsvdsqfthlawintprrqgglgpiripllsdlnhqiskdygvy
ledsghtlrglfiiddkgvlrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkp
gse

SCOPe Domain Coordinates for d3vwvb_:

Click to download the PDB-style file with coordinates for d3vwvb_.
(The format of our PDB-style files is described here.)

Timeline for d3vwvb_: