Lineage for d3vv5a_ (3vv5 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1881030Species Thermus thermophilus [TaxId:262724] [193882] (6 PDB entries)
  8. 1881033Domain d3vv5a_: 3vv5 A: [233871]
    automated match to d1xt8b_
    complexed with slz, so4

Details for d3vv5a_

PDB Entry: 3vv5 (more details), 1.9 Å

PDB Description: Crystal structure of TTC0807 complexed with (S)-2-aminoethyl-L-cysteine (AEC)
PDB Compounds: (A:) Amino acid ABC transporter, binding protein

SCOPe Domain Sequences for d3vv5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vv5a_ c.94.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}
fqvrsfeeikrsgeirigtegafppfnyfdernqltgfevdlgnaiaerlglkprwiaqs
fdtlliqlnqgrfdfviashgiteeraravdftnphyctggvivsrkggprtakdlqgkv
vgvqvgttymeaaqkipgikevrtyqrdpdalqdllagridtwitdrfvakeaikerkle
ntlqvgelvfqervamavakgnkslldalnralaelmqdgtyarisqkwfgedvrck

SCOPe Domain Coordinates for d3vv5a_:

Click to download the PDB-style file with coordinates for d3vv5a_.
(The format of our PDB-style files is described here.)

Timeline for d3vv5a_: