Lineage for d3vura2 (3vur A:76-203)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domainFamily a.45.1.0: automated matches [227130] (1 protein)
not a true familyProtein automated matches [226831] (61 species)
not a true protein
Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (8 PDB entries) 
Domain d3vura2: 3vur A:76-203 [218105]
Other proteins in same PDB: d3vura1
automated match to d1m0ua1
complexed with 1pe, gts
Details for d3vura2
PDB Entry: 3vur (more details), 1.36 Å
PDB Description: Crystal structure of Bombyx mori sigma-class glutathione transferase in complex with glutathionesulfonic acid
PDB Compounds: (A:) Glutathione S-transferase sigmaSCOPe Domain Sequences for d3vura2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vura2 a.45.1.0 (A:76-203) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
lagandeeafeidqnveflndirasaasvhyekdeavkakkkaeleetkypfffeklnei
ltknnghialgkltwgdfvyagmydylkamlqkpdleqkypafrkpieavlaipkvkayv
daaprtel
SCOPe Domain Coordinates for d3vura2:
Click to download the PDB-style file with coordinates for d3vura2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3vura2:
- d3vura2 first appeared in SCOPe 2.03
- d3vura2 appears in SCOPe 2.05
- d3vura2 appears in SCOPe 2.07
- d3vura2 appears in the current release, SCOPe 2.08
View in 3D
