Lineage for d3vura2 (3vur A:76-203)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1736416Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1736417Protein automated matches [226831] (51 species)
    not a true protein
  7. 1736723Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (8 PDB entries)
  8. 1736724Domain d3vura2: 3vur A:76-203 [218105]
    Other proteins in same PDB: d3vura1
    automated match to d1m0ua1
    complexed with 1pe, gts

Details for d3vura2

PDB Entry: 3vur (more details), 1.36 Å

PDB Description: Crystal structure of Bombyx mori sigma-class glutathione transferase in complex with glutathionesulfonic acid
PDB Compounds: (A:) Glutathione S-transferase sigma

SCOPe Domain Sequences for d3vura2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vura2 a.45.1.0 (A:76-203) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
lagandeeafeidqnveflndirasaasvhyekdeavkakkkaeleetkypfffeklnei
ltknnghialgkltwgdfvyagmydylkamlqkpdleqkypafrkpieavlaipkvkayv
daaprtel

SCOPe Domain Coordinates for d3vura2:

Click to download the PDB-style file with coordinates for d3vura2.
(The format of our PDB-style files is described here.)

Timeline for d3vura2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vura1