Lineage for d3vund_ (3vun D:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969596Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)
  8. 1969771Domain d3vund_: 3vun D: [250692]
    Other proteins in same PDB: d3vuna_, d3vunc_, d3vune_
    automated match to d2viub_
    complexed with nag

Details for d3vund_

PDB Entry: 3vun (more details), 3 Å

PDB Description: crystal structure of a influenza a virus (a/aichi/2/1968 h3n2) hemagglutinin in c2 space group.
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d3vund_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vund_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi

SCOPe Domain Coordinates for d3vund_:

Click to download the PDB-style file with coordinates for d3vund_.
(The format of our PDB-style files is described here.)

Timeline for d3vund_: