Lineage for d3vtta_ (3vtt A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (24 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamiliesFamily b.1.18.0: automated matches [191341] (1 protein)
not a true familyProtein automated matches [190226] (43 species)
not a true protein
Species Dengue virus type 3 [TaxId:408870] [193303] (1 PDB entry) 
Domain d3vtta_: 3vtt A: [193304]
automated match to d2jsfa1
complexed with so4
Details for d3vtta_
PDB Entry: 3vtt (more details), 1.7 Å
PDB Description: High Resolution crystal structure of Dengue 3 Envelope protein domain III (ED3)
PDB Compounds: (A:) Envelope protein ESCOPe Domain Sequences for d3vtta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vtta_ b.1.18.0 (A:) automated matches {Dengue virus type 3 [TaxId: 408870]}
syamclntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlitanpv
vtkkeepvnieaeppfgesnivigigdkalkinwyrkgss
SCOPe Domain Coordinates for d3vtta_:
Click to download the PDB-style file with coordinates for d3vtta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3vtta_:
- d3vtta_ first appeared in SCOPe 2.02
- d3vtta_ appears in SCOPe 2.04
- d3vtta_ appears in SCOPe 2.06
- d3vtta_ appears in the current release, SCOPe 2.08
View in 3D
