Lineage for d3vppb_ (3vpp B:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual foldSuperfamily d.169.1: C-type lectin-like [56436] (9 families) 
Family d.169.1.0: automated matches [191331] (1 protein)
not a true familyProtein automated matches [190159] (16 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries) 
Domain d3vppb_: 3vpp B: [195488]
automated match to d1ypqb_
complexed with ca
Details for d3vppb_
PDB Entry: 3vpp (more details), 1.64 Å
PDB Description: crystal structure of the human clec9a c-type lectin-like domain
PDB Compounds: (B:) C-type lectin domain family 9 member ASCOPe Domain Sequences for d3vppb_:
Sequence, based on SEQRES records: (download)
>d3vppb_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spcpnnwiqnrescyyvseiwsiwhtsqenclkegstllqieskeemdfitgslrkikgs
ydywvglsqdghsgrwlwqdgsspspgllpaersqsanqvcgyvksnsllssncdtwkyf
icekyal
Sequence, based on observed residues (ATOM records): (download)
>d3vppb_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spcpnnwiqnrescyyvseiwsiwhtsqenclkegstllqieskeemdfitgslrkikgs
ydywvglsqdghsgrwlwqdgsspspgllpaenqvcgyvksnsllssncdtwkyficeky
al
SCOPe Domain Coordinates for d3vppb_:
Click to download the PDB-style file with coordinates for d3vppb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3vppb_:
- d3vppb_ first appeared in SCOPe 2.02
- d3vppb_ appears in SCOPe 2.05
- d3vppb_ appears in SCOPe 2.07
- d3vppb_ appears in the current release, SCOPe 2.08
View in 3D
