Lineage for d3vo8a2 (3vo8 A:209-316)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) 
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) Protein Cell-division protein FtsZ [55309] (9 species) 
Species Staphylococcus aureus [TaxId:158878] [226456] (6 PDB entries) 
Domain d3vo8a2: 3vo8 A:209-316 [217954]
Other proteins in same PDB: d3vo8a1, d3vo8b1
automated match to d1rq2a2
complexed with ca, gdp
Details for d3vo8a2
PDB Entry: 3vo8 (more details), 2.25 Å
PDB Description: Staphylococcus aureus FtsZ GDP-form
PDB Compounds: (A:) cell division protein ftszSCOPe Domain Sequences for d3vo8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vo8a2 d.79.2.1 (A:209-316) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgfd
SCOPe Domain Coordinates for d3vo8a2:
Click to download the PDB-style file with coordinates for d3vo8a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3vo8a2:
- d3vo8a2 first appeared in SCOPe 2.03
- d3vo8a2 appears in SCOPe 2.06
- d3vo8a2 appears in the current release, SCOPe 2.08
View in 3D
