Lineage for d3vo8a1 (3vo8 A:12-208)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) 
automatically mapped to Pfam PF00091Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) Protein Cell-division protein FtsZ [52492] (9 species) 
Species Staphylococcus aureus [TaxId:158878] [226455] (6 PDB entries) 
Domain d3vo8a1: 3vo8 A:12-208 [217953]
Other proteins in same PDB: d3vo8a2, d3vo8b2
automated match to d1rq2a1
complexed with ca, gdp
Details for d3vo8a1
PDB Entry: 3vo8 (more details), 2.25 Å
PDB Description: Staphylococcus aureus FtsZ GDP-form
PDB Compounds: (A:) cell division protein ftszSCOPe Domain Sequences for d3vo8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vo8a1 c.32.1.1 (A:12-208) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliavsgevn
SCOPe Domain Coordinates for d3vo8a1:
Click to download the PDB-style file with coordinates for d3vo8a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3vo8a1:
- d3vo8a1 is new in SCOPe 2.03-stable
- d3vo8a1 appears in SCOPe 2.04
- d3vo8a1 appears in the current release, SCOPe 2.08
View in 3D
