Lineage for d3viia_ (3vii A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095688Species Neotermes koshunensis [TaxId:60586] [189411] (13 PDB entries)
  8. 2095689Domain d3viia_: 3vii A: [194990]
    automated match to d3ahza_
    complexed with btb, gol, na

Details for d3viia_

PDB Entry: 3vii (more details), 0.97 Å

PDB Description: Crystal structure of beta-glucosidase from termite Neotermes koshunensis in complex with Bis-Tris
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d3viia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3viia_ c.1.8.0 (A:) automated matches {Neotermes koshunensis [TaxId: 60586]}
tvytfpdefklgaatasyqiegawdengkgpniwdtlthehpdyvvdgatgdiaddsyhl
ykedvkilkelgaqvyrfsiswarvlpeghdnivnqdgidyynnlinellangiepmvtm
yhwdlpqalqdlggwpnlvlakysenyarvlfknfgdrvklwltfnepltfmdgyaseig
mapsintpgigdylaahtvihahariyhlydqefraeqggkvgislninwcepatnsaed
rascenyqqfnlglyahpifteegdypavlkdrvsrnsadegytdsrlpqftaeeveyir
gthdflginfytallgksgvegyepsryrdsgviltqdaawpisasswlkvvpwgfrkel
nwikneynnppvfitengfsdygglndtgrvhyytehlkemlkaihedgvnvigytawsl
mdnfewlrgysekfgiyavdfedparpripkesakvlaeimntrkiperfrd

SCOPe Domain Coordinates for d3viia_:

Click to download the PDB-style file with coordinates for d3viia_.
(The format of our PDB-style files is described here.)

Timeline for d3viia_: