Lineage for d3vfja_ (3vfj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913670Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 2913677Species Escherichia coli K-12 [TaxId:83333] [159806] (14 PDB entries)
  8. 2913684Domain d3vfja_: 3vfj A: [261621]
    automated match to d3ruma_
    complexed with act, cac, gcs, man, nag, t55, zn
    has additional insertions and/or extensions that are not grouped together

Details for d3vfja_

PDB Entry: 3vfj (more details), 2.05 Å

PDB Description: the structure of monodechloro-teicoplanin in complex with its ligand, using mbp as a ligand carrier
PDB Compounds: (A:) Maltose-binding periplasmic protein, C-terminal fused by Cys-Lys-D-Ala-D-Ala

SCOPe Domain Sequences for d3vfja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vfja_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli K-12 [TaxId: 83333]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtnaaaaagckaa

SCOPe Domain Coordinates for d3vfja_:

Click to download the PDB-style file with coordinates for d3vfja_.
(The format of our PDB-style files is described here.)

Timeline for d3vfja_: