Lineage for d3vf7a_ (3vf7 A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily)
barrel, closed; n=6, S=10, complex topologySuperfamily b.50.1: Acid proteases [50630] (4 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
dimer of identical mono-domain chains, each containing (6,10) barrelProtein Human immunodeficiency virus type 1 protease [50632] (9 species) 
Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [194276] (21 PDB entries) 
Domain d3vf7a_: 3vf7 A: [192559]
automated match to d3pwma_
complexed with 031, cl, gol, na; mutant
Details for d3vf7a_
PDB Entry: 3vf7 (more details), 1.3 Å
PDB Description: crystal structure of hiv-1 protease mutant l76v with novel p1'-ligands grl-02031
PDB Compounds: (A:) ProteaseSCOPe Domain Sequences for d3vf7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vf7a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvvvgptpvniigrnlltqigatlnf
SCOPe Domain Coordinates for d3vf7a_:
Click to download the PDB-style file with coordinates for d3vf7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3vf7a_:
- d3vf7a_ first appeared in SCOPe 2.02
- d3vf7a_ appears in SCOPe 2.07
View in 3D
