Lineage for d3ve7b_ (3ve7 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) 
Family c.1.2.0: automated matches [191350] (1 protein)
not a true familyProtein automated matches [190292] (36 species)
not a true protein
Species Metallosphaera sedula [TaxId:399549] [226554] (2 PDB entries) 
Domain d3ve7b_: 3ve7 B: [217784]
automated match to d3rlva_
complexed with acy, bmp, so4
Details for d3ve7b_
PDB Entry: 3ve7 (more details), 1.54 Å
PDB Description: Crystal structure of orotidine 5'-monophosphate decarboxylase from Metallosphaera sedula complexed with inhibitor BMP
PDB Compounds: (B:) Orotidine-5'-phosphate decarboxylaseSCOPe Domain Sequences for d3ve7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ve7b_ c.1.2.0 (B:) automated matches {Metallosphaera sedula [TaxId: 399549]}
mnrvilsldspipeetlrklngkvagikvgwplllnlgkekvkelvglvdgikildlkla
didntmilivdelkditnsfiahafvgvegslaslsqrvdlflvlsmshpgwndafypyl
revarrvnpkgfvapatrpsmisrvkgdfpdklvispgvgtqgakpgialchgadyeivg
rsvyqsadpvrkleeivrsqeevls
SCOPe Domain Coordinates for d3ve7b_:
Click to download the PDB-style file with coordinates for d3ve7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ve7b_:
- d3ve7b_ first appeared in SCOPe 2.03
- d3ve7b_ appears in SCOPe 2.07
View in 3D
