Lineage for d3va2b_ (3va2 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992769Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1992770Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1992868Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1993023Protein automated matches [190501] (4 species)
    not a true protein
  7. 1993024Species Human (Homo sapiens) [TaxId:9606] [187448] (17 PDB entries)
  8. 1993054Domain d3va2b_: 3va2 B: [193617]
    automated match to d3qt2c_

Details for d3va2b_

PDB Entry: 3va2 (more details), 2.7 Å

PDB Description: Crystal structure of human Interleukin-5 in complex with its alpha receptor
PDB Compounds: (B:) Interleukin-5

SCOPe Domain Sequences for d3va2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3va2b_ a.26.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggt
verlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewii

SCOPe Domain Coordinates for d3va2b_:

Click to download the PDB-style file with coordinates for d3va2b_.
(The format of our PDB-style files is described here.)

Timeline for d3va2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3va2a_