Lineage for d3v58c_ (3v58 C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718119Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1718294Protein automated matches [190531] (16 species)
    not a true protein
  7. 1718396Species Red alga (Porphyridium purpureum) [TaxId:35688] [194584] (2 PDB entries)
  8. 1718403Domain d3v58c_: 3v58 C: [194586]
    automated match to d1eyxa_
    complexed with peb, so4

Details for d3v58c_

PDB Entry: 3v58 (more details), 1.85 Å

PDB Description: Crystal Structure of the B-phycoerythrin from the red algae Porphyridium Cruentum at pH5
PDB Compounds: (C:) Phycoerythrin alpha subunit

SCOPe Domain Sequences for d3v58c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v58c_ a.1.1.3 (C:) automated matches {Red alga (Porphyridium purpureum) [TaxId: 35688]}
mksvittvvsaadaagrfpsnsdlesiqgniqrsaarleaaeklagnheavvkeagdacf
akyaylknpgeagenqekinkcyrdvdhymrlvnyclvvggtgpldewgiagarevyrtl
nlptsayvasiaytrdrlcvprdmsaqagvefsayldylinals

SCOPe Domain Coordinates for d3v58c_:

Click to download the PDB-style file with coordinates for d3v58c_.
(The format of our PDB-style files is described here.)

Timeline for d3v58c_: