Lineage for d3v4mb_ (3v4m B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952339Protein automated matches [190332] (5 species)
    not a true protein
  7. 2952433Species Mouse (Mus musculus) [TaxId:10090] [188825] (3 PDB entries)
  8. 2952436Domain d3v4mb_: 3v4m B: [195127]
    Other proteins in same PDB: d3v4ma2
    automated match to d1o0pa_
    complexed with cl, na

Details for d3v4mb_

PDB Entry: 3v4m (more details), 1.8 Å

PDB Description: crystal structure of a rna binding domain of a u2 small nuclear ribonucleoprotein auxiliary factor 2 (u2af) from mus musculus at 1.80 a resolution
PDB Compounds: (B:) splicing factor u2af 65 kda subunit

SCOPe Domain Sequences for d3v4mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v4mb_ d.58.7.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgk
ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw

SCOPe Domain Coordinates for d3v4mb_:

Click to download the PDB-style file with coordinates for d3v4mb_.
(The format of our PDB-style files is described here.)

Timeline for d3v4mb_: