Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein automated matches [190332] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188825] (3 PDB entries) |
Domain d3v4mb_: 3v4m B: [195127] Other proteins in same PDB: d3v4ma2 automated match to d1o0pa_ complexed with cl, na |
PDB Entry: 3v4m (more details), 1.8 Å
SCOPe Domain Sequences for d3v4mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v4mb_ d.58.7.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgk ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw
Timeline for d3v4mb_: