Lineage for d3v4da_ (3v4d A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958881Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2958882Protein automated matches [190935] (24 species)
    not a true protein
  7. 2958951Species Escherichia coli [TaxId:217992] [196085] (1 PDB entry)
  8. 2958952Domain d3v4da_: 3v4d A: [201152]
    Other proteins in same PDB: d3v4db2, d3v4dc2, d3v4dd2, d3v4de2, d3v4df2
    automated match to d3v4dc_

Details for d3v4da_

PDB Entry: 3v4d (more details), 1.95 Å

PDB Description: crystal structure of rutc protein a member of the yjgf family from e.coli
PDB Compounds: (A:) Aminoacrylate peracid reductase RutC

SCOPe Domain Sequences for d3v4da_:

Sequence, based on SEQRES records: (download)

>d3v4da_ d.79.1.0 (A:) automated matches {Escherichia coli [TaxId: 217992]}
pksviipagssaplapfvpgtladgvvyvsgtlafdqhnnvlfaddpkaqtrhvletirk
vietaggtmadvtfnsifitdwknyaaineiyaeffpgdkparfciqcglvkpdalveia
tiahia

Sequence, based on observed residues (ATOM records): (download)

>d3v4da_ d.79.1.0 (A:) automated matches {Escherichia coli [TaxId: 217992]}
pksviipagpfvpgtladgvvyvsgtlafdqhnnvlfaddpkaqtrhvletirkvietag
gtmadvtfnsifitdwknyaaineiyaeffpgdkparfciqcglvkpdalveiatiahia

SCOPe Domain Coordinates for d3v4da_:

Click to download the PDB-style file with coordinates for d3v4da_.
(The format of our PDB-style files is described here.)

Timeline for d3v4da_: