| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) ![]() |
| Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
| Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species) |
| Species Streptococcus sp. [TaxId:1320] [193546] (2 PDB entries) |
| Domain d3v3xc_: 3v3x C: [193547] automated match to d2qmta_ complexed with 2pe, act, gol, mtn; mutant |
PDB Entry: 3v3x (more details), 2 Å
SCOPe Domain Sequences for d3v3xc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v3xc_ d.15.7.1 (C:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]}
mqyklilcgktlkgettteavdaataecvfkqyandngvdgewtyddatktftvte
Timeline for d3v3xc_: